Sale!

theresawidechoiceofstellachewysstellasshredrscagefreechickenrecipeinbrothsoutheastpetstochoosefrom0.jpg

theresawidechoiceofstellachewysstellasshredrscagefreechickenrecipeinbrothsoutheastpetstochoosefrom1.jpg

Stella & Chewy’s Stella’s Shredrs Cage Free Chicken Recipe in Broth SOUTHEAST PETS

Name: There's a wide choice of Stella & Chewy's Stella’s Shredrs Cage Free Chicken Recipe in Broth SOUTHEAST PETS to choose from
SKU: mode_7463395786911
Price: 1.07 USD
Availability: InStock

Original price was: $ 1,79.Current price is: $ 1,07.

Title

Clear

SKU: mode_7463395786911 Category: Uncategorized Tags: Brand_Stella & Chewy's, Category_Dog, Dog, Muddy Puppy, Pet, QuickBooks, Stella & Chewy's, Subcategory_Wet Food, Wet Food

Kickstart your dog’s dinner with Stella’s Shredrs — a delicious and nutritious way to make mealtime special. Packed with protein and nutrition, we combine pure shredded and diced muscle meat with a rich nutritious broth for a healthy way to boost your pup’s bowl! This convenient, tear open pouch is ready-to-use anytime as the perfect food topper or a delectable complete & balanced meal all on its own.

Real shredded muscle meat and diced meat in a slowly simmered broth
A boost of extra protein and taste – great for picky pups
Only 4-6 simple wholesome ingredients
Responsibly sourced proteins
Boosted with vitamins and minerals for a complete & balanced meal or topper
Taurine added to support overall heart health
Free from grains, legumes, potatoes, carrageenan, wheat, meat by-products, soy, artificial colors, preservatives and flavors

Ingredients: Chicken, chicken broth, tapioca, sunflower oil, tricalcium phosphate, salt, potassium chloride, choline chloride, vitamin E supplement, magnesium sulfate, taurine, zinc oxide, reduced iron, sodium selenite, manganese sulfate, vitamin B12 supplement, copper amino acid complex, niacin supplement, calcium pantothenate, thiamine mononitrate, vitamin A supplement, biotin, riboflavin supplement, pyridoxine hydrochloride, potassium iodide, beta-carotene, folic acid

Guaranteed Analysis:

Crude Protein (min): 10.00%
Crude Fat (min): 2.00%
Crude Fiber (max): 2.00%
Moisture (max): 83.00%
ME Kcal/kg: 889
ME Kcal/pouch: 71

Title	2.8 Oz

Fast Shipping and Professional Packing

Our long-standing relationships with UPS FedEx DHL and other global carriers gives us the ability to provide a range of shipping services. Our warehouse staff is expertly trained and will wrap your products according to our precise and precise specifications. Your goods will undergo an extensive inspection and be properly packaged prior to being delivered. We ship to thousands of customers each day in different countries. This shows our commitment to become the biggest online retailer on earth. There are distribution centers as well as warehouses across Europe as well as the USA.

Note: Orders with more than one item are assigned a processing time according to the item.

We will inspect each and every one of the items ordered before shipping. Currently, most orders are shipped within 48 hours. The delivery time varies between 3-7 days.

Returns

The inventory is constantly changing and we do not completely manage it because of the fact that several parties are involved, including our warehouse and factory. The levels of stock can change at any given time. Please be aware it's possible your order will be unable to fill once you've placed your order.

Our policy is valid for 30 days. If you haven't received your item within the 30 days period, we are not able to issue a refund or an exchange.

To be eligible for a refund, your product must be unopened and in the same state that you received it. It must also still remain in the original packaging.

Stella & Chewy’s Stella’s Shredrs Cage Free Chicken Recipe in Broth SOUTHEAST PETS

Related products

Login